Myosin Heavy chain 1 (MYH1) Rabbit Polyclonal Antibody

CAT#: TA346424

Rabbit Polyclonal Anti-MYH1 Antibody

Product Images

WB Suggested Anti-MYH1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: COLO205 cell lysate

• 

  Host: Rabbit; Target Name: MYH1; Sample Tissue: OVCAR-3; Antibody Dilution: 1.0 ug/ml; MYH1 is supported by BioGPS gene expression data to be expressed in OVCAR3

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYH1 antibody: synthetic peptide directed towards the N terminal of human MYH1. Synthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 223 kDa
• Gene Name: myosin, heavy chain 1, skeletal muscle, adult
• Database Link:
  NP_005954
  Entrez Gene 4619 Human
  UniProt ID P12882
• Background: Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. Myosin hea
• Synonyms: D; HEL71; MYHa; MyHC-2X; MyHC-2x; MYHSA1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 85%

Reference Data

• Protein Pathways: Tight junction, Viral myocarditis