LSS Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase) (LSS), transcript variant 2, 20 µg
USD 867.00
Transient overexpression lysate of lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase) (LSS), transcript variant 2
USD 665.00
Other products for "LSS"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human, Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LSS antibody: synthetic peptide directed towards the N terminal of human LSS. Synthetic peptide located within the following region: TEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 83 kDa |
Gene Name | lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase) |
Database Link | |
Background | LSS catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. It is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Two transcript variants encoding the same protein have been found for this gene.The protein encoded by this gene catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. The encoded protein is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Two transcript variants encoding the same protein have been found for this gene. |
Synonyms | OSC |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Steroid biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.