Fumarylacetoacetate hydrolase (FAH) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of fumarylacetoacetate hydrolase (fumarylacetoacetase) (FAH)
USD 436.00
Recombinant protein of human fumarylacetoacetate hydrolase (fumarylacetoacetase) (FAH), 20 µg
USD 867.00
Other products for "Fumarylacetoacetate hydrolase"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human, Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the N terminal of human FAH. Synthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 46 kDa |
Gene Name | fumarylacetoacetate hydrolase (fumarylacetoacetase) |
Database Link | |
Background | FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia. This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | FLJ51912 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Dog: 86%; Horse: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Tyrosine metabolism |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.