Cytochrome P450 2D6 (CYP2D6) Rabbit Polyclonal Antibody
Frequently bought together (2)
Recombinant protein of human cytochrome P450, family 2, subfamily D, polypeptide 6 (CYP2D6), transcript variant 2, 20 µg
USD 867.00
Other products for "Cytochrome P450 2D6"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CYP2D6 antibody: synthetic peptide directed towards the N terminal of human CYP2D6. Synthetic peptide located within the following region: RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 55 kDa |
Gene Name | cytochrome P450 family 2 subfamily D member 6 |
Database Link | |
Background | CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Synonyms | CPD6; CYP2D; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2; CYP2DL1; CYPIID6; P450-DB1; P450C2D; P450DB1 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Zebrafish: 92%; Bovine: 91%; Sheep: 86%; Guinea pig: 86%; Dog: 79% |
Reference Data | |
Protein Families | Druggable Genome, P450, Transmembrane |
Protein Pathways | Drug metabolism - cytochrome P450 |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.