SFRS8 (SFSWAP) Rabbit Polyclonal Antibody
Frequently bought together (1)
Other products for "SFRS8"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SFRS8 antibody: synthetic peptide directed towards the N terminal of human SFRS8. Synthetic peptide located within the following region: MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGYACKLFRDDER |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 105 kDa |
Gene Name | splicing factor SWAP homolog |
Database Link | |
Background | SFRS8 is a human homolog of Drosophila splicing regulatory protein.This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Multiple alternatively spliced variants have been identified. Two alternatively spliced variants have been characterized to date. |
Synonyms | SFRS8; SWAP |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%; Bovine: 86%; Rat: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.