SFRS8 (SFSWAP) Rabbit Polyclonal Antibody

CAT#: TA345881

Rabbit Polyclonal Anti-SFRS8 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "SFRS8"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SFRS8 antibody: synthetic peptide directed towards the N terminal of human SFRS8. Synthetic peptide located within the following region: MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGYACKLFRDDER
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 105 kDa
Gene Name splicing factor SWAP homolog
Background SFRS8 is a human homolog of Drosophila splicing regulatory protein.This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Multiple alternatively spliced variants have been identified. Two alternatively spliced variants have been characterized to date.
Synonyms SFRS8; SWAP
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%; Bovine: 86%; Rat: 79%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.