SNRPF Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide F (SNRPF)
USD 436.00
Recombinant protein of human small nuclear ribonucleoprotein polypeptide F (SNRPF), 20 µg
USD 867.00
Other products for "SNRPF"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SNRPF antibody: synthetic peptide directed towards the N terminal of human SNRPF. Synthetic peptide located within the following region: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 9 kDa |
Gene Name | small nuclear ribonucleoprotein polypeptide F |
Database Link | |
Background | SNRPF belongs to the snRNP Sm proteins family and is associated with snRNP U1, U2, U4/U6 and U5. |
Synonyms | Sm-F; SMF; snRNP-F |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 86%; Yeast: 86% |
Reference Data | |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Spliceosome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.