ISG20 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of interferon stimulated exonuclease gene 20kDa (ISG20)
USD 436.00
Recombinant protein of human interferon stimulated exonuclease gene 20kDa (ISG20), 20 µg
USD 867.00
Other products for "ISG20"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ISG20 antibody: synthetic peptide directed towards the middle region of human ISG20. Synthetic peptide located within the following region: TSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 20 kDa |
Gene Name | interferon stimulated exonuclease gene 20kDa |
Database Link | |
Background | ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses. |
Synonyms | CD25; HEM45 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rat: 92%; Horse: 86%; Rabbit: 86%; Dog: 85%; Guinea pig: 85%; Bovine: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.