Germany
Japan
United Kingdom
China
BCL6B Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
Transient overexpression lysate of B-cell CLL/lymphoma 6, member B (zinc finger protein) (BCL6B)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "BCL6B"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-BCL6B antibody: synthetic peptide directed towards the middle region of human BCL6B. Synthetic peptide located within the following region: LQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVE |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 52 kDa |
| Gene Name | B-cell CLL/lymphoma 6B |
| Database Link | |
| Background | BCL6B acts as a sequence-specific transcriptional repressor in association with BCL6. BCL6B may function in a narrow stage or be related to some events in the early B-cell development. |
| Synonyms | BAZF; ZBTB28; ZNF62 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Zebrafish: 86% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.