ZNF366 Rabbit Polyclonal Antibody

CAT#: TA345558

Rabbit Polyclonal Anti-ZNF366 Antibody

Product Images

WB Suggested Anti-ZNF366 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF366 antibody: synthetic peptide directed towards the middle region of human ZNF366. Synthetic peptide located within the following region: LGAEGGQERDCAGRDECLSLRAFQSTRRGPSFSDYLYFKHRDESLKELLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 85 kDa
• Gene Name: zinc finger protein 366
• Database Link:
  NP_689838
  Entrez Gene 167465 Human
  UniProt ID Q8N895
• Background: ZNF366 may be involved in transcriptional regulation.
• Synonyms: DCSCRIPT
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rabbit: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transcription Factors