MINA53 (MINA) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human MYC induced nuclear antigen (MINA), transcript variant 2, 20 µg
USD 867.00
Transient overexpression lysate of MYC induced nuclear antigen (MINA), transcript variant 2
USD 436.00
Other products for "MINA53"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MINA antibody: synthetic peptide directed towards the C terminal of human MINA. Synthetic peptide located within the following region: HGLRFPLSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 53 kDa |
Gene Name | MYC induced nuclear antigen |
Database Link | |
Background | MINA protein is directly involved in ribosome biogenesis, most likely during the assembly process of preribosomal particles. MINA is also involved in cell proliferation. MINA may have a role in esophageal squamous cell carcinoma, colon cancer and lung cancer |
Synonyms | MDIG; MINA53; NO52; ROX |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Mouse: 92%; Bovine: 92%; Guinea pig: 92% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.