OSGEP Rabbit Polyclonal Antibody

CAT#: TA344964

Rabbit Polyclonal Anti-OSGEP Antibody - N-terminal region

Product Images

WB Suggested Anti-OSGEP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OSGEP antibody: synthetic peptide directed towards the N terminal of human OSGEP. Synthetic peptide located within the following region: PPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: O-sialoglycoprotein endopeptidase
• Database Link:
  NP_060277
  Entrez Gene 55644 Human
  UniProt ID Q9NPF4
• Background: O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.
• Synonyms: GCPL1; KAE1; OSGEP1; PRSMG1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Goat: 93%; Guinea pig: 93%; Yeast: 92%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Protease