PNMA8A Rabbit Polyclonal Antibody

CAT#: TA344907

Rabbit Polyclonal Anti-PNMAL1 Antibody - middle region

Product Images

WB Suggested Anti-PNMAL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PNMAL1 antibody: synthetic peptide directed towards the middle region of human PNMAL1. Synthetic peptide located within the following region: APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: paraneoplastic Ma antigen family-like 1
• Database Link:
  NP_060685
  Entrez Gene 55228 Human
  UniProt ID Q86V59
• Background: The function of this protein remains unknown.
• Synonyms: FLJ10781
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 91%