LHPP Rabbit Polyclonal Antibody

CAT#: TA344695

Rabbit Polyclonal Anti-LHPP Antibody - middle region


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), 20 µg
    • 20 ug

USD 867.00

Other products for "LHPP"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LHPP antibody: synthetic peptide directed towards the middle region of human LHPP. Synthetic peptide located within the following region: ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 29 kDa
Gene Name phospholysine phosphohistidine inorganic pyrophosphate phosphatase
Background The function of this protein remains unknown.
Synonyms HDHD2B
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Pig: 83%; Guinea pig: 83%; Horse: 79%; Bovine: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Oxidative phosphorylation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.