Ancient ubiquitous protein 1 (AUP1) Rabbit Polyclonal Antibody

CAT#: TA344606

Rabbit Polyclonal Anti-AUP1 Antibody - N-terminal region

Product Images

Host: Rabbit; Target Name: Aup1; Sample Tissue: Mouse Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Aup1 antibody is synthetic peptide directed towards the N-terminal region of Mouse Aup1. Synthetic peptide located within the following region: MPKDSAFPGAPAALRRWRRQRPRSPEAAAMEPPPAPGPERLFDSHRLPSD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: ancient ubiquitous protein 1
• Database Link:
  NP_853553
  Entrez Gene 11993 Mouse
  UniProt ID Q9Y679
• Background: The function of this protein remains unknown.
• Synonyms: ancient ubiquitous protein 1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 93%; Pig: 87%; Guinea pig: 87%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Dog: 81%

Reference Data

• Protein Families: Druggable Genome, Transmembrane