LRP1 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of low density lipoprotein receptor-related protein 1 (LRP1)
USD 665.00
Other products for "LRP1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LRP1 antibody: synthetic peptide directed towards the middle region of human LRP1. Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 48 kDa |
Gene Name | LDL receptor related protein 1 |
Database Link | |
Background | Low-density lipoprotein receptor-related protein 1 (.-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane. |
Synonyms | A2MR; APOER; APR; CD91; IGFBP3R; LRP; LRP1A; TGFBR5 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Alzheimer's disease |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.