DCUN1D1 Rabbit Polyclonal Antibody

CAT#: TA344174

Rabbit Polyclonal Anti-DCUN1D1 Antibody

Product Images

WB Suggested Anti-DCUN1D1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateDCUN1D1 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DCUN1D1 antibody: synthetic peptide directed towards the N terminal of human DCUN1D1. Synthetic peptide located within the following region: SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: defective in cullin neddylation 1 domain containing 1
• Database Link:
  NP_065691
  Entrez Gene 54165 Human
  UniProt ID Q96GG9
• Background: DCUN1D1 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
• Synonyms: DCNL1; DCUN1L1; RP42; SCCRO; SCRO; Tes3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome