HEXIM2 Rabbit Polyclonal Antibody

CAT#: TA343990

Rabbit Polyclonal Anti-HEXIM2 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of hexamthylene bis-acetamide inducible 2 (HEXIM2)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human hexamthylene bis-acetamide inducible 2 (HEXIM2), 20 µg
    • 20 ug

USD 867.00

Other products for "HEXIM2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HEXIM2 antibody: synthetic peptide directed towards the N terminal of human HEXIM2. Synthetic peptide located within the following region: MATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMES
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 31 kDa
Gene Name hexamethylene bisacetamide inducible 2
Background HEXIM2 belongs to the HEXIM family. It is transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor.In cooperation with 7SK snRNA, HEXIM2 sequesters P-TEFb in a large inactive 7SK snRNP complex preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.
Synonyms L3
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 86%; Horse: 79%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.