BRUNOL6 (CELF6) Rabbit Polyclonal Antibody

CAT#: TA343966

Rabbit Polyclonal Anti-BRUNOL6 Antibody

Product Images

WB Suggested Anti-BRUNOL6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BRUNOL6 antibody: synthetic peptide directed towards the middle region of human BRUNOL6. Synthetic peptide located within the following region: QAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: CUGBP, Elav-like family member 6
• Database Link:
  NP_443072
  Entrez Gene 60677 Human
  UniProt ID Q96J87
• Background: BRUNOL6 is a RNA-binding protein implicated in the regulation of pre-mRNA alternative splicing. It mediates exon inclusion and/or exclusion in pre-mRNAs that are subject to tissue-specific and developmentally regulated alternative splicing. BRUNOL6 specifically activates exon 5 inclusion of TNNT2 in a muscle-specific splicing enhancer (MSE)-dependent manner. It also promotes exon exclusion of INSR pre-mRNA.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.
• Synonyms: BRUNOL6
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%