FAM174C Rabbit Polyclonal Antibody

CAT#: TA343864

Rabbit Polyclonal Anti-C19orf24 Antibody

Product Images

WB Suggested Anti-C19orf24 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C19orf24 antibody: synthetic peptide directed towards the N terminal of human C19orf24. Synthetic peptide located within the following region: MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: chromosome 19 open reading frame 24
• Database Link:
  NP_060384
  Entrez Gene 55009 Human
  UniProt ID Q9BVV8
• Background: C19orf24 is a novel human non-classical secreted protein which is encoded by the hypothetical gene C19orf24 (chromosome 19 open reading frame 24). The exact function of C19orf24 remains unknown.
• Synonyms: FLJ20640
• Note: Immunogen Sequence Homology: Human: 100%