HNF6 (ONECUT1) Rabbit Polyclonal Antibody

CAT#: TA343467

Rabbit Polyclonal Anti-ONECUT1 Antibody

Product Images

WB Suggested Anti-ONECUT1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

• 

  Immunohistochemistry with Human Brain, cerebellum tissue at an antibody concentration of 5.0 ug/ml using anti-ONECUT1 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ONECUT1 antibody: synthetic peptide directed towards the middle region of human ONECUT1. Synthetic peptide located within the following region: ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: one cut homeobox 1
• Database Link:
  NP_004489
  Entrez Gene 3175 Human
  UniProt ID Q9UBC0
• Background: ONECUT1 belongs to the CUT homeobox family. It contains 1 CUT DNA-binding domain and 1 homeobox DNA-binding domain. It is a transcriptional activator. ONECUT1 binds the consensus sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR. It is important for liver genes transcription.
• Synonyms: HNF-6; HNF6; HNF6A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Bovine: 93%; Mouse: 86%; Zebrafish: 79%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: Maturity onset diabetes of the young