TRIP13 Rabbit Polyclonal Antibody

CAT#: TA343449

Rabbit Polyclonal Anti-TRIP13 Antibody

Product Images

WB Suggested Anti-TRIP13 Antibody Titration: 5.0ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysateTRIP13 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Rabbit Anti-TRIP13 antibody Catalog Number: TA343449 Paraffin Embedded Tissue: Human Lung cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X

Specifications

Product Data

• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIP13 antibody: synthetic peptide directed towards the C terminal of human TRIP13. Synthetic peptide located within the following region: LSGRVLRKLPFLAHALYVQAPTVTIEGFLQALSLAVDKQFEERKKLAAYI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: thyroid hormone receptor interactor 13
• Database Link:
  NP_004228
  Entrez Gene 9319 Human
  UniProt ID Q15645
• Background: The thyroid hormone (T3) receptors (TRs) are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. TRIP13 specifically interacts with the ligand binding domain of the TRs. It is a member of Trips (TR-interacting proteins) family. Nearly all of the Trips also show similar ligand-dependent interaction with the retinoid X receptor (RXR), but none interact with the glucocorticoid receptor under any conditions. Trips predict specific functional roles: one is an apparent human homolog of a yeast transcriptional coactivator, one is a new member of a class of nonhistone chromosomal proteins, and one contains a conserved domain associated with ubiquitination of specific target proteins.
• Synonyms: 16E1BP
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 93%; Bovine: 91%; Rat: 86%; Mouse: 86%; Pig: 82%; Guinea pig: 82%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors