ZNF133 Rabbit Polyclonal Antibody

CAT#: TA343396

Rabbit Polyclonal Anti-ZNF133 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 133 (ZNF133), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "ZNF133"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF133 antibody: synthetic peptide directed towards the N terminal of human ZNF133. Synthetic peptide located within the following region: MAFRDVAVDFTQDEWRLLSPAQRTLYREVMLENYSNLVSLGISFSKPELI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 73 kDa
Gene Name zinc finger protein 133
Background ZNF133 may be involved in transcriptional regulation as a repressor.
Synonyms pHZ-13; pHZ-66; ZNF150
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Bovine: 92%; Rabbit: 86%; Pig: 85%; Rat: 83%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.