kynurenine 3 monooxygenase (KMO) Rabbit Polyclonal Antibody

CAT#: TA343355

Rabbit Polyclonal Anti-KMO Antibody

Product Images

Host: Rabbit; Target Name: KMO; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that KMO is expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KMO antibody is: synthetic peptide directed towards the N-terminal region of Human KMO. Synthetic peptide located within the following region: RLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: kynurenine 3-monooxygenase (kynurenine 3-hydroxylase)
• Database Link:
  NP_003670
  Entrez Gene 8564 Human
  UniProt ID O15229
• Background: This gene encodes a mitochondrion outer membrane protein that catalyzes the hydroxylation of L-tryptophan metabolite, L-kynurenine, to form L-3-hydroxykynurenine. Studies in yeast identified this gene as a therapeutic target for Huntington disease.
• Synonyms: dJ317G22.1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 86%; Rabbit: 85%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Tryptophan metabolism