kynurenine 3 monooxygenase (KMO) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO)
USD 665.00
Recombinant protein of human kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (KMO), 20 µg
USD 867.00
Other products for "kynurenine 3 monooxygenase"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KMO antibody is: synthetic peptide directed towards the N-terminal region of Human KMO. Synthetic peptide located within the following region: RLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 49 kDa |
Gene Name | kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) |
Database Link | |
Background | This gene encodes a mitochondrion outer membrane protein that catalyzes the hydroxylation of L-tryptophan metabolite, L-kynurenine, to form L-3-hydroxykynurenine. Studies in yeast identified this gene as a therapeutic target for Huntington disease. |
Synonyms | dJ317G22.1 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 86%; Rabbit: 85%; Mouse: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Tryptophan metabolism |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.