ARHGEF1 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, 20 µg
USD 867.00
Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3
USD 436.00
Other products for "ARHGEF1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ARHGEF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGEF1. Synthetic peptide located within the following region: SAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 102 kDa |
Gene Name | Rho guanine nucleotide exchange factor 1 |
Database Link | |
Background | Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. |
Synonyms | GEF1; LBCL2; LSC; P115-RHOGEF; SUB1.5 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Pig: 86%; Horse: 86% |
Reference Data | |
Protein Pathways | Regulation of actin cytoskeleton, Vascular smooth muscle contraction |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.