TARS2 Rabbit Polyclonal Antibody

CAT#: TA343261

Rabbit Polyclonal Anti-TARS2 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of threonyl-tRNA synthetase 2, mitochondrial (putative) (TARS2), nuclear gene encoding mitochondrial protein
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "TARS2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TARS2 antibody is: synthetic peptide directed towards the C-terminal region of Human TARS2. Synthetic peptide located within the following region: VVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 48 kDa
Gene Name threonyl-tRNA synthetase 2, mitochondrial (putative)
Background The function of this protein remains unknown.
Synonyms COXPD21; TARSL1; thrRS
Note Immunogen Sequence Homology: Human: 100%; Yeast: 100%; Pig: 93%; Bovine: 86%; Dog: 85%; Rat: 79%
Reference Data
Protein Pathways Aminoacyl-tRNA biosynthesis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.