Lysosomal acid lipase (LIPA) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 2
USD 436.00
Recombinant protein of human lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 2, 20 µg
USD 867.00
Other products for "Lysosomal acid lipase"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LIPA antibody: synthetic peptide directed towards the N terminal of human LIPA. Synthetic peptide located within the following region: SYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLAD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 43 kDa |
Gene Name | lipase A, lysosomal acid type |
Database Link | |
Background | This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Synonyms | CESD; LAL |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Rat: 86%; Horse: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Lysosome, Steroid biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.