Lysosomal acid lipase (LIPA) Rabbit Polyclonal Antibody

CAT#: TA343110

Rabbit Polyclonal Anti-LIPA Antibody

Product Images

Host: Rabbit; Target Name: LIPA; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-LIPA Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell LIPA is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LIPA antibody: synthetic peptide directed towards the N terminal of human LIPA. Synthetic peptide located within the following region: SYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLAD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: lipase A, lysosomal acid type
• Database Link:
  NP_000226
  Entrez Gene 3988 Human
  UniProt ID P38571
• Background: This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
• Synonyms: CESD; LAL
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Rat: 86%; Horse: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Lysosome, Steroid biosynthesis