ACSBG1 Rabbit Polyclonal Antibody

CAT#: TA343061

Rabbit Polyclonal Anti-ACSBG1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of acyl-CoA synthetase bubblegum family member 1 (ACSBG1)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human acyl-CoA synthetase bubblegum family member 1 (ACSBG1), 20 µg
    • 20 ug

USD 867.00

Other products for "ACSBG1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ACSBG1 antibody is: synthetic peptide directed towards the N-terminal region of Human ACSBG1. Synthetic peptide located within the following region: DPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQPLSKESLNHALELS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 79 kDa
Gene Name acyl-CoA synthetase bubblegum family member 1
Background The protein encoded by this gene possesses long-chain acyl-CoA synthetase activity. It is thought to play a central role in brain very long-chain fatty acids metabolism and myelinogenesis.
Synonyms BG; BG1; BGM; GR-LACS; LPD
Note Immunogen Sequence Homology: Human: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.