ACSBG1 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of acyl-CoA synthetase bubblegum family member 1 (ACSBG1)
USD 436.00
Recombinant protein of human acyl-CoA synthetase bubblegum family member 1 (ACSBG1), 20 µg
USD 867.00
Other products for "ACSBG1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ACSBG1 antibody is: synthetic peptide directed towards the N-terminal region of Human ACSBG1. Synthetic peptide located within the following region: DPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQPLSKESLNHALELS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 79 kDa |
Gene Name | acyl-CoA synthetase bubblegum family member 1 |
Database Link | |
Background | The protein encoded by this gene possesses long-chain acyl-CoA synthetase activity. It is thought to play a central role in brain very long-chain fatty acids metabolism and myelinogenesis. |
Synonyms | BG; BG1; BGM; GR-LACS; LPD |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.