USP17L2 Rabbit Polyclonal Antibody

CAT#: TA342557

Rabbit Polyclonal Anti-USP17L2 Antibody

Product Images

WB Suggested Anti-USP17L2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-USP17L2 antibody: synthetic peptide directed towards the middle region of human USP17L2. Synthetic peptide located within the following region: FYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: ubiquitin specific peptidase 17-like family member 2
• Database Link:
  NP_958804
  Entrez Gene 377630 Human
  UniProt ID Q6R6M4
• Background: DUB3 is a member of the ubiquitin processing protease (UBP) subfamily of deubiquitinating enzymes. See USP1 (MIM 603478) for background information.
• Synonyms: DUB-3; DUB3; USP17
• Note: Immunogen Sequence Homology: Human: 100%