FOXD4 Rabbit Polyclonal Antibody

CAT#: TA342520

Rabbit Polyclonal Anti-FOXD4 Antibody

Product Images

WB Suggested Anti-FOXD4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate;FOXD4 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOXD4 antibody: synthetic peptide directed towards the middle region of human FOXD4. Synthetic peptide located within the following region: DPASQDMFDNGSFLRRRKRFQRHQPTPGAHLPHPFPLPAAHAALHNPRPG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: forkhead box D4
• Database Link:
  NP_997188
  Entrez Gene 2298 Human
  UniProt ID Q12950
• Background: This gene encodes a member of the forkhead/winged helix-box (FOX) family of transcription factors. FOX transcription factors play critical roles in the regulation of multiple processes including metabolism, cell proliferation and gene expression during ontogenesis. Mutations in this gene are associated with a complex phenotype consisting of dilated cardiomyopathy, obsessive-compulsive disorders, and suicidality. [provided by RefSeq, Mar 2012]
• Synonyms: FKHL9; FOXD4A; FREAC-5; FREAC5
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 85%; Rat: 79%; Horse: 79%

Reference Data

• Protein Families: Transcription Factors