FTO Rabbit Polyclonal Antibody

CAT#: TA342385

Rabbit Polyclonal Anti-FTO Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of fat mass and obesity associated (FTO)
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human fat mass and obesity associated (FTO), 20 µg
    • 20 ug

USD 867.00

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FTO antibody: synthetic peptide directed towards the middle region of human FTO. Synthetic peptide located within the following region: WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 58 kDa
Gene Name fat mass and obesity associated
Background This gene is a nuclear protein of the AlkB related non-haem iron and 2-oxoglutarate-dependent oxygenase superfamily but the exact physiological function of this gene is not known. Other non-heme iron enzymes function to reverse alkylated DNA and RNA damage by oxidative demethylation. Studies in mice and humans indicate a role in nervous and cardiovascular systems and a strong association with body mass index, obesity risk, and type 2 diabetes. [provided by RefSeq, Jul 2011]
Synonyms ALKBH9; BMIQ14; GDFD
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Dog: 86%; Horse: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.