Mybbp1a Rabbit Polyclonal Antibody
Frequently bought together (1)
Other products for "Mybbp1a"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MYBBP1A antibody: synthetic peptide directed towards the C terminal of mouse MYBBP1A. Synthetic peptide located within the following region: DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 148 kDa |
Gene Name | MYB binding protein (P160) 1a |
Database Link | |
Background | Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity. |
Synonyms | FLJ37886; P160; PAP2 |
Note | Immunogen Sequence Homology: Mouse: 100%; Rat: 92%; Pig: 83%; Guinea pig: 83% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.