OSGIN1 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of oxidative stress induced growth inhibitor 1 (OSGIN1), transcript variant 3
USD 436.00
Recombinant protein of human oxidative stress induced growth inhibitor 1 (OSGIN1), transcript variant 1, 20 µg
USD 867.00
Other products for "OSGIN1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-OSGIN1 antibody: synthetic peptide directed towards the N terminal of human OSGIN1. Synthetic peptide located within the following region: APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 61 kDa |
Gene Name | oxidative stress induced growth inhibitor 1 |
Database Link | |
Background | This gene encodes an oxidative stress response protein that regulates cell death. Expression ofThe gene is regulated by p53 and is induced by DNA damage.The protein regulates apoptosis by inducing cytochrome c release from mitochondria. It also appears to be a key regulator of both inflammatory and anti-inflammatory molecules.The loss ofThis protein correlates with uncontrolled cell growth and tumor formation. Naturally occurring read-through transcription exists betweenThis gene andThe neighboring upstream malonyl-CoA decarboxylase (MLYCD) gene, butThe read-through transcripts are unlikely to produce a protein product. [provided by RefSeq, Aug 2011] |
Synonyms | BDGI; OKL38 |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Zebrafish: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.