B3gat2 Rabbit Polyclonal Antibody

CAT#: TA342092

Rabbit Polyclonal Anti-B3gat2 Antibody

Product Images

WB Suggested Anti-B3gat2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Mouse Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-B3gat2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SDFLKQITTVEELEPKASNCTKVLVWHTRTEKVNLANEPKYHLDTVNIEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S)
• Database Link:
  NP_742122
  Entrez Gene 280645 Mouse
  UniProt ID P59270
• Background: B3gat2 is involved inThe biosynthesis of L2/HNK-1 carbohydrate epitope on both glycolipids and glycoproteins.
• Synonyms: GlcAT-D; GlcAT-S; GLCATS; Glucuronosyltransferase-S; KIAA1963; MGC138535; UDP-glucuronosyltransferase-S
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Pig: 92%; Rat: 92%; Guinea pig: 92%