B3gat2 Rabbit Polyclonal Antibody
Frequently bought together (1)
Other products for "B3gat2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-B3gat2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SDFLKQITTVEELEPKASNCTKVLVWHTRTEKVNLANEPKYHLDTVNIEV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 37 kDa |
Gene Name | beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S) |
Database Link | |
Background | B3gat2 is involved inThe biosynthesis of L2/HNK-1 carbohydrate epitope on both glycolipids and glycoproteins. |
Synonyms | GlcAT-D; GlcAT-S; GLCATS; Glucuronosyltransferase-S; KIAA1963; MGC138535; UDP-glucuronosyltransferase-S |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Pig: 92%; Rat: 92%; Guinea pig: 92% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.