TMEM127 Rabbit Polyclonal Antibody

CAT#: TA342042

Rabbit Polyclonal Anti-TMEM127 Antibody

Product Images

WB Suggested Anti-TMEM127 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM127 antibody: synthetic peptide directed towards the middle region of human TMEM127. Synthetic peptide located within the following region: AFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: transmembrane protein 127
• Database Link:
  NP_060319
  Entrez Gene 55654 Human
  UniProt ID O75204
• Background: This gene encodes a transmembrane protein with 3 predicted transmembrane domains.The protein is associated with a subpopulation of vesicular organelles corresponding to early endosomal structures, withThe Golgi, and with lysosomes, and may participate in protein trafficking betweenThese structures. Mutations inThis gene and several other genes cause pheochromocytomas. Alternatively spliced transcript variants encodingThe same protein have been identified. [provided by RefSeq, Aug 2010]
• Synonyms: FLJ20507; FLJ22257
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane