DR6 (TNFRSF21) Rabbit Polyclonal Antibody

CAT#: TA341938

Rabbit Polyclonal Anti-TNFRSF21 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TNFRSF21 antibody: synthetic peptide directed towards the N terminal of human TNFRSF21. Synthetic peptide located within the following region: TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 68 kDa
Gene Name tumor necrosis factor receptor superfamily member 21
Background This gene encodes a member ofThe tumor necrosis factor receptor superfamily.The encoded protein activates nuclear factor kappa-B and mitogen-activated protein kinase 8 (also called c-Jun N-terminal kinase 1), and induces cell apoptosis. Through its death domain,The encoded receptor interacts with tumor necrosis factor receptor type 1-associated death domain (TRADD) protein, which is known to mediate signal transduction of tumor necrosis factor receptors. Knockout studies in mice suggest thatThis gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation. [provided by RefSeq, Jul 2013]
Synonyms BM-018; CD358; DR6
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Bovine: 92%; Rat: 91%; Mouse: 91%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.