DR6 (TNFRSF21) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 21 (TNFRSF21)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "DR6"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TNFRSF21 antibody: synthetic peptide directed towards the N terminal of human TNFRSF21. Synthetic peptide located within the following region: TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 68 kDa |
Gene Name | tumor necrosis factor receptor superfamily member 21 |
Database Link | |
Background | This gene encodes a member ofThe tumor necrosis factor receptor superfamily.The encoded protein activates nuclear factor kappa-B and mitogen-activated protein kinase 8 (also called c-Jun N-terminal kinase 1), and induces cell apoptosis. Through its death domain,The encoded receptor interacts with tumor necrosis factor receptor type 1-associated death domain (TRADD) protein, which is known to mediate signal transduction of tumor necrosis factor receptors. Knockout studies in mice suggest thatThis gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation. [provided by RefSeq, Jul 2013] |
Synonyms | BM-018; CD358; DR6 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Bovine: 92%; Rat: 91%; Mouse: 91% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.