MAN1A2 Rabbit Polyclonal Antibody

CAT#: TA341856

Rabbit Polyclonal Anti-MAN1A2 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "MAN1A2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MAN1A2 antibody: synthetic peptide directed towards the middle region of human MAN1A2. Synthetic peptide located within the following region: FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 73 kDa
Gene Name mannosidase alpha class 1A member 2
Background Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells. See MAN2A1 (MIM 154582) for general information. [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: BC052954.1, AF027156.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END##
Synonyms MAN1B
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%
Reference Data
Protein Families Transmembrane
Protein Pathways Metabolic pathways, N-Glycan biosynthesis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.