PGRMC1 Rabbit Polyclonal Antibody

CAT#: TA341853

Rabbit Polyclonal Anti-PGRMC1 Antibody


USD 539.00

2 Weeks*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of progesterone receptor membrane component 1 (PGRMC1)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human progesterone receptor membrane component 1 (PGRMC1), 20 µg
    • 20 ug

USD 867.00

Other products for "PGRMC1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PGRMC1 antibody: synthetic peptide directed towards the N terminal of human PGRMC1. Synthetic peptide located within the following region: MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 22 kDa
Gene Name progesterone receptor membrane component 1
Background This gene encodes a putative membrane-associated progesterone steroid receptor.The protein is expressed predominantly inThe liver and kidney. [provided by RefSeq, Mar 2010]
Synonyms HPR6.6; MPR
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Rabbit: 86%; Bovine: 79%
Reference Data
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.