FOXA3 Rabbit Polyclonal Antibody

CAT#: TA341776

Rabbit Polyclonal Anti-Foxa3 Antibody

Product Images

WB Suggested Anti-Foxa3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Mouse Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Foxa3 antibody: synthetic peptide directed towards the c terminal of mouse Foxa3. Synthetic peptide located within the following region: YNFNHPFSINNLMSEQTSTPSKLDVGFGGYGAESGEPGVYYQSLYSRSLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: forkhead box A3
• Database Link:
  NP_004488
  Entrez Gene 15377 Mouse
  UniProt ID P55318
• Background: Foxa3 is a transcription factor that is thought to act as a 'pioneer' factor openingThe compacted chromatin for other proteins through interactions with nucleosomal core histones andThereby replacing linker histones at target enhancer and/or promoter sites. Foxa3 is originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Foxa3 interacts withThe cis-acting regulatory regions ofThese genes.Foxa3 is involved in glucose homeostasis; activates GLUT2 transcription and regulation of neuronal-specific transcription. Foxa3 is also involved in regulation of spermatogenesis; required forThe maintenance ofThe testicular germ cell population and male fertility.
• Synonyms: FKHH3; HNF3G; TCF3G
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 86%; Horse: 86%; Human: 86%; Bovine: 86%; Dog: 79%; Guinea pig: 79%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: Maturity onset diabetes of the young