Nucleobindin 2 (NUCB2) Rabbit Polyclonal Antibody

CAT#: TA341643

Rabbit Polyclonal Anti-NUCB2 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Purified recombinant protein of Homo sapiens nucleobindin 2 (NUCB2), 20 µg
    • 20 ug

USD 867.00

Other products for "Nucleobindin 2"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human, Mouse, Canine
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 46 kDa
Gene Name nucleobindin 2
Background This gene encodes a protein with a suggested role in calcium level maintenance, eating regulation inThe hypothalamus, and release of tumor necrosis factor from vascular endothelial cells.This protein binds calcium and has EF-folding domains. [provided by RefSeq, Oct 2011]
Synonyms HEL-S-109; NEFA
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Yeast: 91%; Guinea pig: 86%
Reference Data
Protein Families Secreted Protein, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.