DDX42 Rabbit Polyclonal Antibody
Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 42 (DDX42), transcript variant 2
USD 665.00
Other products for "DDX42"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DDX42 antibody: synthetic peptide directed towards the N terminal of human DDX42. Synthetic peptide located within the following region: PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 103 kDa |
Gene Name | DEAD-box helicase 42 |
Database Link | |
Background | This gene encodes a member ofThe Asp-Glu-Ala-Asp (DEAD) box protein family. Members ofThis protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Two transcript variants encodingThe same protein have been identified forThis gene. [provided by RefSeq, Jul 2008] |
Synonyms | DDX42P; RHELP; RNAHP; SF3B8; SF3b125 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Pathways | Spliceosome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.