SOHLH1 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of spermatogenesis and oogenesis specific basic helix-loop-helix 1 (SOHLH1), transcript variant 1
USD 436.00
Recombinant protein of human spermatogenesis and oogenesis specific basic helix-loop-helix 1 (SOHLH1), transcript variant 2, 20 µg
USD 867.00
Other products for "SOHLH1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SOHLH1 antibody: synthetic peptide directed towards the middle region of human SOHLH1. Synthetic peptide located within the following region: EAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 42 kDa |
Gene Name | spermatogenesis and oogenesis specific basic helix-loop-helix 1 |
Database Link | |
Background | This gene encodes one of testis-specific transcription factors which are essential for spermatogenesis, oogenesis and folliculogenesis.This gene is located on chromosome 9. Mutations inThis gene are associated with nonobstructive azoospermia. Alternatively spliced transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Aug 2013] |
Synonyms | bA100C15.3; bHLHe80; C9orf157; NOHLH; SPATA27; TEB2 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.