DIRAS1 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of DIRAS family, GTP-binding RAS-like 1 (DIRAS1)
USD 436.00
Recombinant protein of human DIRAS family, GTP-binding RAS-like 1 (DIRAS1), 20 µg
USD 867.00
Other products for "DIRAS1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DIRAS1 antibody: synthetic peptide directed towards the N terminal of human DIRAS1. Synthetic peptide located within the following region: PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 22 kDa |
Gene Name | DIRAS family GTPase 1 |
Database Link | |
Background | DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases.DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases. [supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3390 BC030660.1 2-3391 |
Synonyms | Di-Ras1; GBTS1; RIG |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 93%; Yeast: 91%; Sheep: 79%; Rabbit: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.