KIAA1970 (EARS2) Rabbit Polyclonal Antibody

CAT#: TA339988

Rabbit Polyclonal Anti-EARS2 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of glutamyl-tRNA synthetase 2, mitochondrial (putative) (EARS2), nuclear gene encoding mitochondrial protein, transcript variant 1
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "KIAA1970"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-EARS2 antibody: synthetic peptide directed towards the middle region of human EARS2. Synthetic peptide located within the following region: TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 59 kDa
Gene Name glutamyl-tRNA synthetase 2, mitochondrial
Background EARS2 belongs to the class-I aminoacyl-tRNA synthetase family. The function of the EARS2 protein is not known.
Synonyms COXPD12; gluRS; MSE1
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Pig: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 93%; Yeast: 91%; Dog: 86%; Horse: 86%; Rabbit: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways Aminoacyl-tRNA biosynthesis, Metabolic pathways, Porphyrin and chlorophyll metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.