REG3A Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 1
USD 436.00
Recombinant protein of human regenerating islet-derived 3 alpha (REG3A), transcript variant 1, 20 µg
USD 867.00
Other products for "REG3A"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-REG3A antibody: synthetic peptide directed towards the N terminal of human REG3A. Synthetic peptide located within the following region: GSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 17 kDa |
Gene Name | regenerating family member 3 alpha |
Database Link | |
Background | This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. Alternate splicing results in multiple transcript variants that encode the same protein. |
Synonyms | HIP; INGAP; PAP; PAP-H; PAP1; PBCGF; REG-III; REG3 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Sheep: 86% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.