FIP200 (RB1CC1) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of RB1-inducible coiled-coil 1 (RB1CC1), transcript variant 1
USD 436.00
Other products for "FIP200"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RB1CC1 antibody: synthetic peptide directed towards the C terminal of human RB1CC1. Synthetic peptide located within the following region: SGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 183 kDa |
Gene Name | RB1 inducible coiled-coil 1 |
Database Link | |
Background | RB1CC1 is implicated in the regulation of RB1 expression. It functions as a DNA-binding transcription factor. RB1CC1 is a potent regulator of the RB1 pathway and a mediator that plays a crucial role in muscular differentiation. The expression of RB1CC1 is, thus, a prerequisite for myogenic differentiation. RB1CC1 is frequently mutated in breast cancer and shows characteristics of a classical tumor suppressor gene. |
Synonyms | ATG17; CC1; FIP200; PPP1R131 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.