ZNF226 Rabbit Polyclonal Antibody

CAT#: TA339652

Rabbit Polyclonal Anti-ZNF226 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 226 (ZNF226), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "ZNF226"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF226 antibody: synthetic peptide directed towards the C terminal of human ZNF226. Synthetic peptide located within the following region: KSFGRSAHLQAHQKVHTGDKPYKCDECGKGFKWSLNLDMHQRVHTGEKPY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 92 kDa
Gene Name zinc finger protein 226
Background ZNF226 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 19 C2H2-type zinc fingers and 1 KRAB domain. ZNF226 may be involved in transcriptional regulation.
Synonyms Kruppel-associated box protein; zinc finger protein 226
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 92%; Mouse: 86%; Guinea pig: 86%; Zebrafish: 85%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.