St6gal2 Rabbit Polyclonal Antibody

CAT#: TA339615

Rabbit Polyclonal Anti-St6gal2 Antibody

Product Images

WB Suggested Anti-St6gal2 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-St6gal2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: beta galactoside alpha 2,6 sialyltransferase 2
• Database Link:
  NP_766417
  Entrez Gene 240119 Mouse
  UniProt ID Q76K27
• Background: The function of this protein remains unknown.
• Synonyms: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2; FLJ30711; FLJ37730; FLJ38334; KIAA1877; SIAT2; ST6Gal-II; ST6GalII
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%; Guinea pig: 86%; Horse: 79%