PPAPDC1B (PLPP5) Rabbit Polyclonal Antibody

CAT#: TA339613

Rabbit Polyclonal Anti-PPAPDC1B Antibody

Product Images

WB Suggested Anti-PPAPDC1B Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPAPDC1B antibody: synthetic peptide directed towards the middle region of human PPAPDC1B. Synthetic peptide located within the following region: KLIVGRPRPDFFYRCFPDGLAHSDLMCTGDKDVVNEGRKSFPSGHSSFAF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: phospholipid phosphatase 5
• Database Link:
  NP_001096029
  Entrez Gene 84513 Human
  UniProt ID Q8NEB5
• Background: PPAPDC1B is a multi-pass membrane protein and it belongs to the PA-phosphatase related phosphoesterase family. It may be a metastatic suppressor for hepatocellular carcinoma.
• Synonyms: DPPL1; HTPAP; PPAPDC1B
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 86%; Rabbit: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane