Apolipoprotein L 2 (APOL2) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of apolipoprotein L, 2 (APOL2), transcript variant alpha
USD 436.00
Recombinant protein of human apolipoprotein L, 2 (APOL2), transcript variant alpha, 20 µg
USD 867.00
Other products for "Apolipoprotein L 2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-APOL2 antibody: synthetic peptide directed towards the middle region of human APOL2. Synthetic peptide located within the following region: DVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 37 kDa |
Gene Name | apolipoprotein L2 |
Database Link | |
Background | This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. Two transcript variants encoding the same protein have been found for this gene. |
Synonyms | APOL-II; APOL3 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 79% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.