ZNF307 (ZKSCAN4) Rabbit Polyclonal Antibody

CAT#: TA339511

Rabbit Polyclonal Anti-ZNF307 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of zinc finger with KRAB and SCAN domains 4 (ZKSCAN4)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human zinc finger with KRAB and SCAN domains 4 (ZKSCAN4), 20 µg
    • 20 ug

USD 867.00

Other products for "ZNF307"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF307 antibody: synthetic peptide directed towards the N terminal of human ZNF307. Synthetic peptide located within the following region: MAREPRKNAALDAQSAEDQTGLLTVKVEKEEASALTAEVRAPCSPARGPE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 62 kDa
Gene Name zinc finger with KRAB and SCAN domains 4
Background ZNF307 contains 1 SCAN box domain, 1 KRAB domain and 7 C2H2-type zinc fingers. It belongs to the Krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Synonyms P1P373C6; ZNF307; ZNF427; ZSCAN36
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 92%; Rabbit: 85%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.